Lineage for d1xwad_ (1xwa D:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 698982Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 698983Superfamily c.47.1: Thioredoxin-like [52833] (22 families) (S)
  5. 698984Family c.47.1.1: Thioltransferase [52834] (15 proteins)
  6. 699045Protein Thioredoxin [52835] (12 species)
  7. 699111Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [117589] (4 PDB entries)
  8. 699115Domain d1xwad_: 1xwa D: [116119]
    complexed with cd, cl

Details for d1xwad_

PDB Entry: 1xwa (more details), 2.2 Å

PDB Description: Drospohila thioredoxin, oxidized, P41212
PDB Compounds: (D:) thioredoxin

SCOP Domain Sequences for d1xwad_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xwad_ c.47.1.1 (D:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
mvyqvkdkadldgqltkasgklvvldffatwcgpckmispklvelstqfadnvvvlkvdv
decediameynissmptfvflkngvkveefaganakrledvikani

SCOP Domain Coordinates for d1xwad_:

Click to download the PDB-style file with coordinates for d1xwad_.
(The format of our PDB-style files is described here.)

Timeline for d1xwad_: