SCOP 1.75: Domain d1xu1s_: 1xu1 S:

Lineage for d1xu1s_ (1xu1 S:)

1. Root: SCOP 1.75

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.24: TNF receptor-like [57585] (1 superfamily)
   duplication: consists of three similar disulfide-rich domains

4. Superfamily g.24.1: TNF receptor-like [57586] (2 families)

5. Family g.24.1.2: BAFF receptor-like [90174] (3 proteins)
   only fragments of the receptor structures are available; no domain division is provided here

6. Protein Tumor necrosis factor receptor superfamily member 13B, TACI [118262] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [118263] (2 PDB entries)
   Uniprot O14836 68-109

8. Domain d1xu1s_: 1xu1 S: [116037]
   Other proteins in same PDB: d1xu1a_, d1xu1b_, d1xu1d_

Details for d1xu1s_

PDB Entry: 1xu1, 1.9 Å

PDB Description: The crystal structure of APRIL bound to TACI

PDB Compounds: (S:) Tumor necrosis factor receptor superfamily member 13B

SCOP Domain Sequences for d1xu1s_:

Sequence; same for both SEQRES and ATOM records:

>d1xu1s_ g.24.1.2 (S:) Tumor necrosis factor receptor superfamily member 13B, TACI {Human (Homo sapiens) [TaxId: 9606]}
crkeqgkfydhllrdciscasicgqhpkqcayfcen

Timeline for d1xu1s_:

• d1xu1s_ first appeared in SCOP 1.71
  
• d1xu1s_ appears in SCOP 1.73
  
• d1xu1s_ appears in SCOPe 2.01
  
• d1xu1s_ appears in the current release, SCOPe 2.08