Lineage for d1xpuf2 (1xpu F:48-126)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1540029Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1541119Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1541496Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
    barrel, closed; n=5, S=8
  6. 1541712Protein Rho termination factor, RNA-binding domain [68910] (1 species)
  7. 1541713Species Escherichia coli [TaxId:562] [68911] (9 PDB entries)
    Uniprot P03002
  8. 1541725Domain d1xpuf2: 1xpu F:48-126 [115806]
    Other proteins in same PDB: d1xpua1, d1xpua3, d1xpub1, d1xpub3, d1xpuc1, d1xpuc3, d1xpud1, d1xpud3, d1xpue1, d1xpue3, d1xpuf1, d1xpuf3
    protein/RNA complex; complexed with ags, fpd, mg

Details for d1xpuf2

PDB Entry: 1xpu (more details), 3.05 Å

PDB Description: Structural mechanism of inhibition of the Rho transcription termination factor by the antibiotic 5a-(3-formylphenylsulfanyl)-dihydrobicyclomycin (FPDB)
PDB Compounds: (F:) Rho transcription termination factor

SCOPe Domain Sequences for d1xpuf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xpuf2 b.40.4.5 (F:48-126) Rho termination factor, RNA-binding domain {Escherichia coli [TaxId: 562]}
difgdgvleilqdgfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkeg
eryfallkvnevnfdkpen

SCOPe Domain Coordinates for d1xpuf2:

Click to download the PDB-style file with coordinates for d1xpuf2.
(The format of our PDB-style files is described here.)

Timeline for d1xpuf2: