Class b: All beta proteins [48724] (176 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) |
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins) barrel, closed; n=5, S=8 |
Protein Rho termination factor, RNA-binding domain [68910] (1 species) |
Species Escherichia coli [TaxId:562] [68911] (9 PDB entries) Uniprot P03002 |
Domain d1xprd2: 1xpr D:48-126 [115782] Other proteins in same PDB: d1xpra1, d1xpra3, d1xprb1, d1xprb3, d1xprc1, d1xprc3, d1xprd1, d1xprd3, d1xpre1, d1xpre3, d1xprf1, d1xprf3 protein/RNA complex; complexed with ags, fb, mg |
PDB Entry: 1xpr (more details), 3.15 Å
SCOPe Domain Sequences for d1xprd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xprd2 b.40.4.5 (D:48-126) Rho termination factor, RNA-binding domain {Escherichia coli [TaxId: 562]} difgdgvleilqdgfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkeg eryfallkvnevnfdkpen
Timeline for d1xprd2: