Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.163: DNA breaking-rejoining enzymes [56348] (1 superfamily) core: alpha3-beta3-alpha4; one side of beta-sheet is exposed |
Superfamily d.163.1: DNA breaking-rejoining enzymes [56349] (2 families) |
Family d.163.1.1: Lambda integrase-like, catalytic core [56350] (6 proteins) |
Protein Cre recombinase [56355] (1 species) |
Species Bacteriophage P1 [TaxId:10678] [56356] (20 PDB entries) Uniprot P06956 20-341 |
Domain d1xo0b2: 1xo0 B:130-341 [115677] Other proteins in same PDB: d1xo0a1, d1xo0b1 protein/DNA complex |
PDB Entry: 1xo0 (more details), 2 Å
SCOPe Domain Sequences for d1xo0b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xo0b2 d.163.1.1 (B:130-341) Cre recombinase {Bacteriophage P1 [TaxId: 10678]} rakqalafertdfdqvrslmensdrcqdirnlaflgiayntllkiaeiarirvkdisrtd ggrmlihigrtktlvstagvekalslgvtklverwisvsgvaddpnnylfcrvrkngvaa psatsqlstralegifeathrliygakddsgqrylawsghsarvgaardmaragvsipei mqaggwtnvnivmnyirnldsetgamvrlled
Timeline for d1xo0b2: