Lineage for d1xnrq_ (1xnr Q:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 798661Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 799407Superfamily b.40.4: Nucleic acid-binding proteins [50249] (16 families) (S)
  5. 799717Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (30 proteins)
    barrel, closed; n=5, S=8
  6. 800031Protein Ribosomal protein S17 [50304] (3 species)
  7. 800061Species Thermus thermophilus [TaxId:274] [50305] (45 PDB entries)
    Uniprot P24321
  8. 800074Domain d1xnrq_: 1xnr Q: [115642]
    Other proteins in same PDB: d1xnrb_, d1xnrc1, d1xnrc2, d1xnrd_, d1xnre1, d1xnre2, d1xnrf_, d1xnrg_, d1xnrh_, d1xnri_, d1xnrj_, d1xnrk_, d1xnrl_, d1xnrm_, d1xnrn_, d1xnro_, d1xnrp_, d1xnrr_, d1xnrs_, d1xnrt_, d1xnrv_
    complexed with mg, par, zn

Details for d1xnrq_

PDB Entry: 1xnr (more details), 3.1 Å

PDB Description: Crystal Structure of an Inosine-Cytosine Wobble Base Pair in the Context of the Decoding Center
PDB Compounds: (Q:) 16S Ribosomal protein S17

SCOP Domain Sequences for d1xnrq_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xnrq_ b.40.4.5 (Q:) Ribosomal protein S17 {Thermus thermophilus [TaxId: 274]}
pkkvltgvvvsdkmqktvtvlverqfphplygkvikrskkylahdpeekyklgdvveiie
srpiskrkrfrvlrlvesgrmdlvekylirrqnyqslskrggka

SCOP Domain Coordinates for d1xnrq_:

Click to download the PDB-style file with coordinates for d1xnrq_.
(The format of our PDB-style files is described here.)

Timeline for d1xnrq_: