SCOP 1.71: Domain d1xjsa_: 1xjs A:

Lineage for d1xjsa_ (1xjs A:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.224: SufE/NifU [82648] (1 superfamily)
   alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123

4. Superfamily d.224.1: SufE/NifU [82649] (2 families)
   iron-sulfur cluster assembly proteins

5. Family d.224.1.2: NifU/IscU domain [102928] (4 proteins)

6. Protein NifU [117910] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [117911] (1 PDB entry)

8. Domain d1xjsa_: 1xjs A: [115392]
   Structural genomics target
   complexed with zn

Details for d1xjsa_

PDB Entry: 1xjs

PDB Description: solution structure of iron-sulfur cluster assembly protein iscu from bacillus subtilis, with zinc bound at the active site. northeast structural genomics consortium target sr17

SCOP Domain Sequences for d1xjsa_:

Sequence; same for both SEQRES and ATOM records:

>d1xjsa_ d.224.1.2 (A:) NifU {Bacillus subtilis}
msfnanldtlyrqvimdhyknprnkgvlndsivvdmnnptcgdrirltmkldgdivedak
fegegcsismasasmmtqaikgkdietalsmskifsdmmqgkeyddsidlgdiealqgvs
kfparikcatlswkalekgvakeeggn

Timeline for d1xjsa_:

• d1xjsa_ is new in SCOP 1.71
  
• d1xjsa_ appears in SCOP 1.73
  
• d1xjsa_ appears in the current release, SCOPe 2.08