PDB entry 1xjs

View 1xjs on RCSB PDB site
Description: solution structure of iron-sulfur cluster assembly protein iscu from bacillus subtilis, with zinc bound at the active site. northeast structural genomics consortium target sr17
Deposited on 2004-09-24, released 2005-01-04
The last revision prior to the SCOP 1.71 freeze date was dated 2005-01-04, with a file datestamp of 2005-01-04.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.71: d1xjsa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1xjsA (A:)
  msfnanldtlyrqvimdhyknprnkgvlndsivvdmnnptcgdrirltmkldgdivedak
  fegegcsismasasmmtqaikgkdietalsmskifsdmmqgkeyddsidlgdiealqgvs
  kfparikcatlswkalekgvakeeggn