Lineage for d1xfea2 (1xfe A:2-44)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2637892Fold g.12: LDL receptor-like module [57423] (1 superfamily)
    disulfide-rich calcium-binding fold
  4. 2637893Superfamily g.12.1: LDL receptor-like module [57424] (2 families) (S)
  5. 2637894Family g.12.1.1: LDL receptor-like module [57425] (7 proteins)
  6. 2637904Protein Ligand-binding domain of low-density lipoprotein receptor [57426] (1 species)
  7. 2637905Species Human (Homo sapiens) [TaxId:9606] [57427] (13 PDB entries)
    Uniprot P01130 272-353
  8. 2637913Domain d1xfea2: 1xfe A:2-44 [115260]
    Other proteins in same PDB: d1xfea1, d1xfea3
    complexed with ca

Details for d1xfea2

PDB Entry: 1xfe (more details)

PDB Description: solution structure of the la7-egfa pair from the ldl receptor
PDB Compounds: (A:) low-density lipoprotein receptor

SCOPe Domain Sequences for d1xfea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xfea2 g.12.1.1 (A:2-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]}
nvtlcegpnkfkchsgecitldkvcnmardcrdwsdepikecg

SCOPe Domain Coordinates for d1xfea2:

Click to download the PDB-style file with coordinates for d1xfea2.
(The format of our PDB-style files is described here.)

Timeline for d1xfea2: