Lineage for d1xcge2 (1xcg E:942-1081)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803067Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
    Pfam PF00169
  6. 2803258Protein Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF [117254] (1 species)
  7. 2803259Species Human (Homo sapiens) [TaxId:9606] [117255] (5 PDB entries)
    Uniprot O15085 714-1081
  8. 2803261Domain d1xcge2: 1xcg E:942-1081 [115124]
    Other proteins in same PDB: d1xcga1, d1xcgb_, d1xcge1, d1xcgf_

Details for d1xcge2

PDB Entry: 1xcg (more details), 2.5 Å

PDB Description: crystal structure of human rhoa in complex with dh/ph fragment of pdzrhogef
PDB Compounds: (E:) Rho guanine nucleotide exchange factor 11

SCOPe Domain Sequences for d1xcge2:

Sequence, based on SEQRES records: (download)

>d1xcge2 b.55.1.1 (E:942-1081) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]}
atalerasnplaaefksldlttrkmihegpltwriskdktldlhvllledllvllqkqde
klllkchsktavgssdskqtfspvlklnavlirsvatdkraffiictsklgppqiyelva
ltssdkntwmelleeavrna

Sequence, based on observed residues (ATOM records): (download)

>d1xcge2 b.55.1.1 (E:942-1081) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]}
atalerasnplaaefksldlttrkmihegpltwriskdktldlhvllledllvllqkqde
klllkchsktfspvlklnavlirsvatdkraffiictsklgppqiyelvaltssdkntwm
elleeavrna

SCOPe Domain Coordinates for d1xcge2:

Click to download the PDB-style file with coordinates for d1xcge2.
(The format of our PDB-style files is described here.)

Timeline for d1xcge2: