![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (22 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.1: Papain-like [54002] (25 proteins) |
![]() | Protein Staphopain SspB [102721] (1 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [102722] (3 PDB entries) Uniprot Q70UQ9 41-393 |
![]() | Domain d1x9yb1: 1x9y B:223-393 [115013] Other proteins in same PDB: d1x9ya2, d1x9yb2, d1x9yc2, d1x9yd2 |
PDB Entry: 1x9y (more details), 2.5 Å
SCOP Domain Sequences for d1x9yb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x9yb1 d.3.1.1 (B:223-393) Staphopain SspB {Staphylococcus aureus [TaxId: 1280]} qyentlknfkireqqfdnswcagfsmaallnatkntdtynahdimrtlypevseqdlpnc atfpnqmieygksqgrdihyqegvpsynqvdqltkdnvgimilaqsvsqnpndphlghal avvgnakindqekliywnpwdtelsiqdadssllhlsfnrdynwygsmigy
Timeline for d1x9yb1: