Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) |
Family d.14.1.5: GHMP Kinase, N-terminal domain [54232] (7 proteins) |
Protein Galactokinase [102762] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [117793] (1 PDB entry) Uniprot P51570 |
Domain d1wuud1: 1wuu D:2-216 [114906] Other proteins in same PDB: d1wuua2, d1wuua3, d1wuub2, d1wuuc2, d1wuuc3, d1wuud2, d1wuud3 complexed with anp, gla, mg |
PDB Entry: 1wuu (more details), 2.5 Å
SCOPe Domain Sequences for d1wuud1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wuud1 d.14.1.5 (D:2-216) Galactokinase {Human (Homo sapiens) [TaxId: 9606]} aalrqpqvaellaearrafreefgaepelavsapgrvnligehtdynqglvlpmalelmt vlvgsprkdglvsllttsegadepqrlqfplptaqrslepgtprwanyvkgviqyypaap lpgfsavvvssvplggglsssaslevatytflqqlcpdsgtiaaraqvcqqaehsfagmp cgimdqfislmgqkghallidcrsletslvplsdp
Timeline for d1wuud1: