Lineage for d1wuud1 (1wuu D:2-216)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2537228Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2537229Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2537678Family d.14.1.5: GHMP Kinase, N-terminal domain [54232] (7 proteins)
  6. 2537687Protein Galactokinase [102762] (3 species)
  7. 2537688Species Human (Homo sapiens) [TaxId:9606] [117793] (1 PDB entry)
    Uniprot P51570
  8. 2537692Domain d1wuud1: 1wuu D:2-216 [114906]
    Other proteins in same PDB: d1wuua2, d1wuua3, d1wuub2, d1wuuc2, d1wuuc3, d1wuud2, d1wuud3
    complexed with anp, gla, mg

Details for d1wuud1

PDB Entry: 1wuu (more details), 2.5 Å

PDB Description: crystal structure of human galactokinase complexed with mgamppnp and galactose
PDB Compounds: (D:) Galactokinase

SCOPe Domain Sequences for d1wuud1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wuud1 d.14.1.5 (D:2-216) Galactokinase {Human (Homo sapiens) [TaxId: 9606]}
aalrqpqvaellaearrafreefgaepelavsapgrvnligehtdynqglvlpmalelmt
vlvgsprkdglvsllttsegadepqrlqfplptaqrslepgtprwanyvkgviqyypaap
lpgfsavvvssvplggglsssaslevatytflqqlcpdsgtiaaraqvcqqaehsfagmp
cgimdqfislmgqkghallidcrsletslvplsdp

SCOPe Domain Coordinates for d1wuud1:

Click to download the PDB-style file with coordinates for d1wuud1.
(The format of our PDB-style files is described here.)

Timeline for d1wuud1: