Lineage for d1wj1a_ (1wj1 A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1550800Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 1550801Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 1551068Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (13 proteins)
    Pfam PF00640
  6. 1551110Protein Numb [50762] (2 species)
  7. 1551114Species Mouse (Mus musculus) [TaxId:10090] [117256] (1 PDB entry)
    Uniprot Q9QZS3 19-172
  8. 1551115Domain d1wj1a_: 1wj1 A: [114688]
    Structural genomics target

Details for d1wj1a_

PDB Entry: 1wj1 (more details)

PDB Description: solution structure of phosphotyrosine interaction domain of mouse numb protein
PDB Compounds: (A:) numb protein

SCOPe Domain Sequences for d1wj1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wj1a_ b.55.1.2 (A:) Numb {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgasrphqwqtdeegvrtgkcsfpvkylghvevdesrgmhicedavkrlkatgkk
avkavlwvsadglrvvdektkdlivdqtiekvsfcapdrnfdrafsyicrdgttrrwich
cfmavkdtgerlshavgcafaaclerkqkrsgpssg

SCOPe Domain Coordinates for d1wj1a_:

Click to download the PDB-style file with coordinates for d1wj1a_.
(The format of our PDB-style files is described here.)

Timeline for d1wj1a_: