SCOPe 2.07: Domain d1wi1a1: 1wi1 A:8-120

Lineage for d1wi1a1 (1wi1 A:8-120)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
   Pfam PF00169

6. Protein Calcium-dependent activator protein for secretion, CAPS [117252] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117253] (1 PDB entry)
   Uniprot Q8NFR0 522-634

8. Domain d1wi1a1: 1wi1 A:8-120 [114658]
   Other proteins in same PDB: d1wi1a2, d1wi1a3
   Structural genomics target

Details for d1wi1a1

PDB Entry: 1wi1

PDB Description: solution structure of the ph domain of human calcium-dependent activator protein for secretion (caps)

PDB Compounds: (A:) calcium-dependent activator protein for secretion, CAPS

SCOPe Domain Sequences for d1wi1a1:

Sequence; same for both SEQRES and ATOM records:

>d1wi1a1 b.55.1.1 (A:8-120) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]}
mkhsgylwaigknvwkrwkkrffvlvqvsqytfamcsyrekkaepqellqldgytvdytd
pqpgleggraffnavkegdtvifasddeqdrilwvqamyratgqshkpvpptq

Timeline for d1wi1a1:

• d1wi1a1 first appeared in SCOP 1.71, called d1wi1a_
  
• d1wi1a1 appears in SCOPe 2.06
  
• d1wi1a1 appears in the current release, SCOPe 2.08