Lineage for d1wgxa1 (1wgx A:8-67)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305223Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 2305482Family a.4.1.3: Myb/SANT domain [46739] (16 proteins)
  6. 2305519Protein Hypothetical protein C14orf106 (KIAA1903) [116782] (1 species)
  7. 2305520Species Human (Homo sapiens) [TaxId:9606] [116783] (1 PDB entry)
    Uniprot Q6P0N0 877-936
  8. 2305521Domain d1wgxa1: 1wgx A:8-67 [114626]
    Other proteins in same PDB: d1wgxa2, d1wgxa3
    Structural genomics target

Details for d1wgxa1

PDB Entry: 1wgx (more details)

PDB Description: solution structure of rsgi ruh-022, a myb dna-binding domain in human cdna
PDB Compounds: (A:) KIAA1903 protein

SCOPe Domain Sequences for d1wgxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wgxa1 a.4.1.3 (A:8-67) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]}
dkewnekelqklhcafaslpkhkpgfwsevaaavgsrspeecqrkymenprgkgsqkhvt

SCOPe Domain Coordinates for d1wgxa1:

Click to download the PDB-style file with coordinates for d1wgxa1.
(The format of our PDB-style files is described here.)

Timeline for d1wgxa1: