SCOPe 2.07: Domain d1wgna1: 1wgn A:8-57

Lineage for d1wgna1 (1wgn A:8-57)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
   3 helices; bundle, right-handed twist

4. Superfamily a.5.2: UBA-like [46934] (5 families)

5. Family a.5.2.1: UBA domain [46935] (25 proteins)

6. Protein Ubiquitin-associated protein 1, UBAP1 [116830] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [116831] (1 PDB entry)
   Uniprot Q9NZ09 381-430

8. Domain d1wgna1: 1wgn A:8-57 [114617]
   Other proteins in same PDB: d1wgna2, d1wgna3
   Structural genomics target

Details for d1wgna1

PDB Entry: 1wgn

PDB Description: solution structure of uba domain of human ubiquitin associated protein 1 (ubap1)

PDB Compounds: (A:) ubiquitin associated protein

SCOPe Domain Sequences for d1wgna1:

Sequence; same for both SEQRES and ATOM records:

>d1wgna1 a.5.2.1 (A:8-57) Ubiquitin-associated protein 1, UBAP1 {Human (Homo sapiens) [TaxId: 9606]}
ayselqmlspserqcvetvvnmgysyecvlramkkkgenieqildylfah

Timeline for d1wgna1:

• d1wgna1 first appeared in SCOP 1.71, called d1wgna_
  
• d1wgna1 appears in SCOPe 2.06
  
• d1wgna1 appears in the current release, SCOPe 2.08