Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.3: MoaD/ThiS [54285] (5 families) possible link between the ubiquitin-like and 2Fe-2S ferredoxin-like superfamilies |
Family d.15.3.3: C9orf74 homolog [117833] (1 protein) automatically mapped to Pfam PF09138 |
Protein C9orf74 homolog [117834] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [117835] (2 PDB entries) Uniprot Q9D2P4 # |
Domain d1wgka_: 1wgk A: [114614] Structural genomics target |
PDB Entry: 1wgk (more details)
SCOPe Domain Sequences for d1wgka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wgka_ d.15.3.3 (A:) C9orf74 homolog {Mouse (Mus musculus) [TaxId: 10090]} gssgssgmaaplcvkvefgggaellfdgvkkhqvalpgqeepwdirnllvwikknllker pelfiqgdsvrpgilvlindadwellgeldyqlqdqdsilfistlhggsgpssg
Timeline for d1wgka_: