Lineage for d1wb8b2 (1wb8 B:93-208)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 859482Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 859483Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family) (S)
  5. 859484Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins)
  6. 859512Protein Fe superoxide dismutase (FeSOD) [54725] (10 species)
  7. 859554Species Archaeon Sulfolobus solfataricus [TaxId:2287] [54730] (2 PDB entries)
    Uniprot P80857
  8. 859556Domain d1wb8b2: 1wb8 B:93-208 [114485]
    Other proteins in same PDB: d1wb8a1, d1wb8b1
    complexed with fe, pms

Details for d1wb8b2

PDB Entry: 1wb8 (more details), 2.3 Å

PDB Description: iron superoxide dismutase (fe-sod) from the hyperthermophile sulfolobus solfataricus. 2.3 a resolution structure of recombinant protein with a covalently modified tyrosine in the active site.
PDB Compounds: (B:) superoxide dismutase [fe]

SCOP Domain Sequences for d1wb8b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wb8b2 d.44.1.1 (B:93-208) Fe superoxide dismutase (FeSOD) {Archaeon Sulfolobus solfataricus [TaxId: 2287]}
psgkgggkpggaladlinkqygsfdrfkqvftetanslpgtgwavlyydtesgnlqimtf
enhfqnhiaeipiilildefehayylqyknkradyvnawwnvvnwdaaekklqkyl

SCOP Domain Coordinates for d1wb8b2:

Click to download the PDB-style file with coordinates for d1wb8b2.
(The format of our PDB-style files is described here.)

Timeline for d1wb8b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wb8b1