Class a: All alpha proteins [46456] (289 folds) |
Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) automatically mapped to Pfam PF00081 |
Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins) |
Protein Fe superoxide dismutase (FeSOD) [46611] (10 species) |
Species Sulfolobus solfataricus [TaxId:2287] [46616] (2 PDB entries) Uniprot P80857 |
Domain d1wb7b1: 1wb7 B:4-92 [114480] Other proteins in same PDB: d1wb7a2, d1wb7b2 complexed with fe; mutant |
PDB Entry: 1wb7 (more details), 2.24 Å
SCOPe Domain Sequences for d1wb7b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wb7b1 a.2.11.1 (B:4-92) Fe superoxide dismutase (FeSOD) {Sulfolobus solfataricus [TaxId: 2287]} iqfkkyelpplpykidalepyiskdiidvhynghhkgfvngansllerlekvvkgdlqtg qydiqgiirgltfninghklhalywenma
Timeline for d1wb7b1: