Class b: All beta proteins [48724] (149 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (3 families) |
Family b.43.3.1: Elongation factors [50448] (9 proteins) |
Protein Elongation factor SelB, domains 2 and 4 [117218] (1 species) EF-Tu homologue, contains extra C-terminal domain (domain 4) of the same fold as the postG domain 2 |
Species Methanococcus maripaludis [TaxId:39152] [117219] (3 PDB entries) |
Domain d1wb2c1: 1wb2 C:180-271 [114457] Other proteins in same PDB: d1wb2a3, d1wb2a4, d1wb2b2, d1wb2b3, d1wb2c3, d1wb2c4, d1wb2d2, d1wb2d3 |
PDB Entry: 1wb2 (more details), 3.1 Å
SCOP Domain Sequences for d1wb2c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wb2c1 b.43.3.1 (C:180-271) Elongation factor SelB, domains 2 and 4 {Methanococcus maripaludis} rntesyfkmpldhafpikgagtvvtgtinkgivkvgdelkvlpinmstkvrsiqyfkesv meakagdrvgmaiqgvdakqiyrgciltskdt
Timeline for d1wb2c1: