Lineage for d1wb2c1 (1wb2 C:180-271)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 560964Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 560975Superfamily b.43.3: Translation proteins [50447] (3 families) (S)
  5. 560976Family b.43.3.1: Elongation factors [50448] (9 proteins)
  6. 561003Protein Elongation factor SelB, domains 2 and 4 [117218] (1 species)
    EF-Tu homologue, contains extra C-terminal domain (domain 4) of the same fold as the postG domain 2
  7. 561004Species Methanococcus maripaludis [TaxId:39152] [117219] (3 PDB entries)
  8. 561014Domain d1wb2c1: 1wb2 C:180-271 [114457]
    Other proteins in same PDB: d1wb2a3, d1wb2a4, d1wb2b2, d1wb2b3, d1wb2c3, d1wb2c4, d1wb2d2, d1wb2d3

Details for d1wb2c1

PDB Entry: 1wb2 (more details), 3.1 Å

PDB Description: Crystal structure of translation elongation factor SelB from Methanococcus maripaludis, apo form

SCOP Domain Sequences for d1wb2c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wb2c1 b.43.3.1 (C:180-271) Elongation factor SelB, domains 2 and 4 {Methanococcus maripaludis}
rntesyfkmpldhafpikgagtvvtgtinkgivkvgdelkvlpinmstkvrsiqyfkesv
meakagdrvgmaiqgvdakqiyrgciltskdt

SCOP Domain Coordinates for d1wb2c1:

Click to download the PDB-style file with coordinates for d1wb2c1.
(The format of our PDB-style files is described here.)

Timeline for d1wb2c1: