![]() | Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (45 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein Elongation factor SelB, N-terminal domain [117537] (1 species) |
![]() | Species Methanococcus maripaludis [TaxId:39152] [117538] (3 PDB entries) |
![]() | Domain d1wb2b3: 1wb2 B:1-179 [114456] Other proteins in same PDB: d1wb2a1, d1wb2a2, d1wb2a3, d1wb2b1, d1wb2b2, d1wb2c1, d1wb2c2, d1wb2c3, d1wb2d1, d1wb2d2 |
PDB Entry: 1wb2 (more details), 3.1 Å
SCOP Domain Sequences for d1wb2b3:
Sequence, based on SEQRES records: (download)
>d1wb2b3 c.37.1.8 (B:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis} mdfkninlgifghidhgkttlskvlteiastsahdklpesqkrgitidigfsafklenyr itlvdapghadliravvsaadiidlalivvdakegpktqtgehmlildhfnipiivvitk sdnagteeikrtemimksilqsthnlknssiipisaktgfgvdelknliittlnnaeii
>d1wb2b3 c.37.1.8 (B:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis} mdfkninlgifghidhgkttlskvlteiaspesqkrgitidigfsafklenyritlvdap ghadliravvsaadiidlalivvdakegpktqtgehmlildhfnipiivvitksdnagte eikrtemimksilqsthnlknssiipisaktgfgvdelknliittlnnaeii
Timeline for d1wb2b3: