SCOPe 2.07: Domain d1w8oa1: 1w8o A:403-505

Lineage for d1w8oa1 (1w8o A:403-505)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins)
   domains of unknown function associated with different type of catalytic domains in a different sequential location
   subgroup of the larger IPT/TIG domain family

6. Protein Sialidase, "linker" domain [49237] (1 species)
   follows the catalytic six-bladed beta-propeller domain

7. Species Micromonospora viridifaciens [TaxId:1881] [49238] (4 PDB entries)
   Uniprot Q02834 47-647

8. Domain d1w8oa1: 1w8o A:403-505 [114374]
   Other proteins in same PDB: d1w8oa2, d1w8oa3
   complexed with cit, gol, lbt, na

Details for d1w8oa1

PDB Entry: 1w8o, 1.7 Å

PDB Description: contribution of the active site aspartic acid to catalysis in the bacterial neuraminidase from micromonospora viridifaciens

PDB Compounds: (A:) bacterial sialidase

SCOPe Domain Sequences for d1w8oa1:

Sequence; same for both SEQRES and ATOM records:

>d1w8oa1 b.1.18.2 (A:403-505) Sialidase, "linker" domain {Micromonospora viridifaciens [TaxId: 1881]}
gicapftipdvalepgqqvtvpvavtnqsgiavpkpslqldaspdwqvqgsveplmpgrq
akgqvtitvpagttpgryrvgatlrtsagnasttftvtvglld

Timeline for d1w8oa1:

• d1w8oa1 first appeared in SCOP 1.71
  
• d1w8oa1 appears in SCOPe 2.06
  
• d1w8oa1 appears in the current release, SCOPe 2.08