Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88571] (22 PDB entries) Uniprot Q8N355 20-230 # 94% sequence identity; natural chimera: antibody light chain (Fab HYB3) |
Domain d1w72m2: 1w72 M:108-211 [114306] Other proteins in same PDB: d1w72a1, d1w72a2, d1w72b1, d1w72b2, d1w72d1, d1w72d2, d1w72e1, d1w72e2, d1w72h1, d1w72h2, d1w72i1, d1w72i2, d1w72l1, d1w72m1 complexed with gol |
PDB Entry: 1w72 (more details), 2.15 Å
SCOPe Domain Sequences for d1w72m2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w72m2 b.1.1.2 (M:108-211) Immunoglobulin light chain lambda constant domain, CL-lambda {Mouse (Mus musculus) [TaxId: 10090]} qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskq snnkyaassylsltpeqwkshrsyscqvthegstvektvap
Timeline for d1w72m2: