Lineage for d1w5cg_ (1w5c G:)

  1. Root: SCOP 1.75
  2. 896322Class i: Low resolution protein structures [58117] (26 folds)
  3. 897741Fold i.5: Photosystems [58155] (1 superfamily)
  4. 897742Superfamily i.5.1: Photosystems [58156] (1 family) (S)
  5. 897743Family i.5.1.1: Photosystems [58157] (5 proteins)
    not a true family
  6. 897757Protein Photosystem II [58160] (2 species)
    there is a higher resolution structure of Thermosynechococcus elongatus photosystem II (1s5l); however, PDB entry 1S5L designates protein chains by both upper case and lower case letters creating problems with its processing and presentation; there are two copies of the photosystem II complex: one with the upper case chains and the other with lower case chains
    there is a higher resolution structure of Thermosynechococcus elongatus photosystem II (1s5l); however, PDB entry 1S5L designates protein chains by both upper case and lower case letters creating problems with its processing and presentation; there are two copies of the photosystem II complex: one with the upper case chains and the other with lower case chains
  7. 897795Species Thermosynechococcus vulcanus [TaxId:32053] [82945] (2 PDB entries)
  8. 897830Domain d1w5cg_: 1w5c G: [114221]

Details for d1w5cg_

PDB Entry: 1w5c (more details), 3.2 Å

PDB Description: Photosystem II from Thermosynechococcus elongatus
PDB Compounds: (G:) Photosystem Q(B) protein

SCOP Domain Sequences for d1w5cg_:

Sequence, based on SEQRES records: (download)

>d1w5cg_ i.5.1.1 (G:) Photosystem II {Thermosynechococcus vulcanus [TaxId: 32053]}
resanlwerfcnwvtstdnrlyvgwfgvimiptllaaticfviafiaappvdidgirepv
sgsllygnniitgavvpssnaiglhfypiweaasldewlynggpyqliifhfllgascym
grqwelsyrlgmrpwicvaysaplasafavfliypigqgsfsdgmplgisgtfnfmivfq
aehnilmhpfhqlgvagvfggalfcamhgslvtsslirettetesanygykfgqeeetyn
ivaahgyfgrlifqyasfnnsrslhfflaawpvvgvwftalgistmafnlngfnfnhsvi
dakgnvintwadiinranlgmevmhernahnfpl

Sequence, based on observed residues (ATOM records): (download)

>d1w5cg_ i.5.1.1 (G:) Photosystem II {Thermosynechococcus vulcanus [TaxId: 32053]}
resanlwerfcnwvtstdnrlyvgwfgvimiptllaaticfviafiaappvdidgirepv
sgsllygnniitgavvpssnaiglhfypiweaasldewlynggpyqliifhfllgascym
grqwelsyrlgmrpwicvaysaplasafavfliypigqgsfsdgmplgisgtfnfmivfq
aehnilmhpfhqlgvagvfggalfcamhgslvtsslirettetesygykfgqeeetyniv
aahgyfgrlifqyasfnnsrslhfflaawpvvgvwftalgistmafnlngfnfnhsvida
kgnvintwadiinranlgmevmhernahnfpl

SCOP Domain Coordinates for d1w5cg_:

Click to download the PDB-style file with coordinates for d1w5cg_.
(The format of our PDB-style files is described here.)

Timeline for d1w5cg_: