![]() | Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.10: Aldolase [51569] (6 families) ![]() Common fold covers whole protein structure |
![]() | Family c.1.10.1: Class I aldolase [51570] (12 proteins) the catalytic lysine forms schiff-base intermediate with substrate possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels |
![]() | Protein Decameric fructose-6-phosphate aldolase/transaldolase [75085] (2 species) forms helix-swapped pentamers |
![]() | Species Thermotoga maritima [TaxId:243274] [117379] (1 PDB entry) |
![]() | Domain d1vpxc_: 1vpx C: [113979] |
PDB Entry: 1vpx (more details), 2.4 Å
SCOP Domain Sequences for d1vpxc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vpxc_ c.1.10.1 (C:) Decameric fructose-6-phosphate aldolase/transaldolase {Thermotoga maritima} hmkifldtanleeikkgvewgivdgvttnptliskegaefkqrvkeicdlvkgpvsaevv sldyegmvrearelaqiseyvvikipmtpdgikavktlsaegiktnvtlvfspaqailaa kagatyvspfvgrmddlsndgmrmlgeiveiynnygfeteiiaasirhpmhvveaalmgv divtmpfavleklfkhpmtdlgierfme
Timeline for d1vpxc_: