![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.12: ABC transporter ATPase domain-like [52686] (20 proteins) there are two additional subdomains inserted into the central core that has a RecA-like topology |
![]() | Protein Hypothetical protein PH0022, N-terminal domain [117546] (1 species) |
![]() | Species Pyrococcus horikoshii [TaxId:53953] [117547] (2 PDB entries) |
![]() | Domain d1vcia3: 1vci A:7-245 [113609] Other proteins in same PDB: d1vcia1, d1vcia2 complexed with atp |
PDB Entry: 1vci (more details), 2.9 Å
SCOP Domain Sequences for d1vcia3:
Sequence, based on SEQRES records: (download)
>d1vcia3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} vikmvevklenltkrfgnftavnklnltikdgeflvllgpsgcgktttlrmiagleepte griyfgdrdvtylppkdrnismvfqsyavwphmtvyeniafplkikkfpkdeidkrvrwa aellqieellnrypaqlsggqrqrvavaraivvepdvllmdeplsnldaklrvamraeik klqqklkvttiyvthdqveamtmgdriavmnrgqllqigsptevylrpnsvfvatfiga
>d1vcia3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} vikmvevklenltkrfgnftavnklnltikdgeflvllgpsgcgktttlrmiagleepte griyfgdrdvtylppkdrnismvfqhmtvyeniafplkkfpkdeidkrvrwaaellqiee llnrypaqlsggqrqrvavaraivvepdvllmdeplsnldaklrvamraeikklqqklkv ttiyvthdqveamtmgdriavmnrgqllqigsptevylrpnsvfvatfiga
Timeline for d1vcia3: