Lineage for d1vcia1 (1vci A:246-299)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 667292Fold b.40: OB-fold [50198] (12 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 668809Superfamily b.40.6: MOP-like [50331] (3 families) (S)
  5. 668893Family b.40.6.3: ABC-transporter additional domain [50338] (3 proteins)
    probably stems out from the biMOP domain
  6. 668907Protein Hypothetical protein PH0022, C-terminal domain [117208] (1 species)
  7. 668908Species Pyrococcus horikoshii [TaxId:53953] [117209] (2 PDB entries)
  8. 668911Domain d1vcia1: 1vci A:246-299 [113607]
    Other proteins in same PDB: d1vcia3

Details for d1vcia1

PDB Entry: 1vci (more details), 2.9 Å

PDB Description: Crystal structure of the ATP-binding cassette of multisugar transporter from Pyrococcus horikoshii OT3 complexed with ATP
PDB Compounds: (A:) sugar-binding transport ATP-binding protein

SCOP Domain Sequences for d1vcia1:

Sequence, based on SEQRES records: (download)

>d1vcia1 b.40.6.3 (A:246-299) Hypothetical protein PH0022, C-terminal domain {Pyrococcus horikoshii [TaxId: 53953]}
pemnilevsvgdgylegrgfrielpqdlmdllkdyvgktvlfgirpehmtvegv

Sequence, based on observed residues (ATOM records): (download)

>d1vcia1 b.40.6.3 (A:246-299) Hypothetical protein PH0022, C-terminal domain {Pyrococcus horikoshii [TaxId: 53953]}
pemnilevsvgdgylegrgfrielpqmdllkdyvgktvlfgirpehmtvegv

SCOP Domain Coordinates for d1vcia1:

Click to download the PDB-style file with coordinates for d1vcia1.
(The format of our PDB-style files is described here.)

Timeline for d1vcia1: