Class a: All alpha proteins [46456] (285 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel |
Family a.29.3.1: Medium chain acyl-CoA dehydrogenase-like, C-terminal domain [47204] (10 proteins) |
Protein Medium chain acyl-CoA dehydrogenase, C-domain [47207] (3 species) |
Species Thermus thermophilus [TaxId:274] [116882] (1 PDB entry) Uniprot Q5SJ70 32-409 |
Domain d1ukwa1: 1ukw A:259-410 [113263] Other proteins in same PDB: d1ukwa2, d1ukwb2 complexed with co, fad |
PDB Entry: 1ukw (more details), 2.4 Å
SCOPe Domain Sequences for d1ukwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ukwa1 a.29.3.1 (A:259-410) Medium chain acyl-CoA dehydrogenase, C-domain {Thermus thermophilus [TaxId: 274]} gegfkiamqtlnktripvaagsvgvarraldearkyakereafgepianfqaiqfklvdm ligietarmytyyaawladqglphahasaiakayaseiafeaanqaiqihggygyvrefp vekllrdvklnqiyegtneiqrliiarhilaa
Timeline for d1ukwa1: