SCOPe 2.03: Domain d1u9kb_: 1u9k B:

Lineage for d1u9kb_ (1u9k B:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein TREM-1 (triggering receptor expressed on myeloid cells 1) [101506] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [117037] (1 PDB entry)
   Uniprot Q9JKE2 25-134

8. Domain d1u9kb_: 1u9k B: [113245]
   complexed with zn

Details for d1u9kb_

PDB Entry: 1u9k, 1.76 Å

PDB Description: Crystal Structure of Mouse Triggering Receptor Expressed on Myeloid Cells 1 (TREM-1) at 1.76

PDB Compounds: (B:) triggering receptor expressed on myeloid cells 1

SCOPe Domain Sequences for d1u9kb_:

Sequence; same for both SEQRES and ATOM records:

>d1u9kb_ b.1.1.1 (B:) TREM-1 (triggering receptor expressed on myeloid cells 1) {Mouse (Mus musculus) [TaxId: 10090]}
eeerydlvegqtltvkcpfnimkyansqkawqrlpdgkepltlvvtqrpftrpsevhmgk
ftlkhdpseamlqvqmtdlqvtdsglyrcviyhppndpvvlfhpvrlvvt

Timeline for d1u9kb_:

• d1u9kb_ first appeared in SCOP 1.71
  
• d1u9kb_ appears in SCOPe 2.02
  
• d1u9kb_ appears in SCOPe 2.04
  
• d1u9kb_ appears in the current release, SCOPe 2.08