SCOPe 2.03: Domain d1u81a_: 1u81 A:

Lineage for d1u81a_ (1u81 A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein ADP-ribosylation factor [52614] (16 species)

7. Species Human (Homo sapiens), ARF1 [TaxId:9606] [52615] (12 PDB entries)
   Uniprot P32889

8. Domain d1u81a_: 1u81 A: [113113]
   complexed with gdp, mg

Details for d1u81a_

PDB Entry: 1u81

PDB Description: Delta-17 Human ADP Ribosylation Factor 1 Complexed with GDP

PDB Compounds: (A:) ADP-ribosylation factor 1

SCOPe Domain Sequences for d1u81a_:

Sequence; same for both SEQRES and ATOM records:

>d1u81a_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]}
mrilmvgldaagkttilyklklgeivttiptigfnvetveyknisftvwdvggqdkirpl
wrhyfqntqglifvvdsndrervneareelmrmlaedelrdavllvfankqdlpnamnaa
eitdklglhslrhrnwyiqatcatsgdglyegldwlsnqlrnqk

Timeline for d1u81a_:

• d1u81a_ first appeared in SCOP 1.71
  
• d1u81a_ appears in SCOPe 2.02
  
• d1u81a_ appears in SCOPe 2.04
  
• d1u81a_ appears in the current release, SCOPe 2.08