Lineage for d1u5qb_ (1u5q B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1671717Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1671718Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1671838Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1673809Protein Serine/threonine protein kinase TAO2 [118127] (1 species)
    OPK group; serine/threonine kinase
  7. 1673810Species Norway rat (Rattus norvegicus) [TaxId:10116] [118128] (3 PDB entries)
    Uniprot Q9JLS3 12-320
  8. 1673814Domain d1u5qb_: 1u5q B: [113049]
    complexed with ca

Details for d1u5qb_

PDB Entry: 1u5q (more details), 2.1 Å

PDB Description: Crystal Structure of the TAO2 Kinase Domain: Activation and Specifity of a Ste20p MAP3K
PDB Compounds: (B:) serine/threonine protein kinase TAO2

SCOPe Domain Sequences for d1u5qb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u5qb_ d.144.1.7 (B:) Serine/threonine protein kinase TAO2 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dpdvaelffkddpeklfsdlreighgsfgavyfardvrnsevvaikkmsysgkqsnekwq
diikevrflqklrhpntiqyrgcylrehtawlvmeyclgsasdllevhkkplqeveiaav
thgalqglaylhshnmihrdvkagnillsepglvklgdfgsasimapansfvgtpywmap
evilamdegqydgkvdvwslgitcielaerkpplfnmnamsalyhiaqnespalqsghws
eyfrnfvdsclqkipqdrptsevllkhrfvlrerpptvimdliqrtkdavreldnlqyrk
mkkilfqea

SCOPe Domain Coordinates for d1u5qb_:

Click to download the PDB-style file with coordinates for d1u5qb_.
(The format of our PDB-style files is described here.)

Timeline for d1u5qb_: