![]() | Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) ![]() |
![]() | Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (16 proteins) N-terminal all-beta domain defines family |
![]() | Protein Alcohol dehydrogenase [51737] (9 species) |
![]() | Species Human (Homo sapiens), different isozymes [TaxId:9606] [51739] (22 PDB entries) |
![]() | Domain d1u3vb2: 1u3v B:163-338 [113012] Other proteins in same PDB: d1u3va1, d1u3vb1 complexed with hpl, nad, po4, zn |
PDB Entry: 1u3v (more details), 1.65 Å
SCOP Domain Sequences for d1u3vb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u3vb2 c.2.1.1 (B:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes} asplekvcligcgfstgygsavnvakvtpgstcavfglggvglsavmgckaagaariiav dinkdkfakakelgatecinpqdykkpiqevlkemtdggvdfsfevigrldtmmasllcc heacgtsvivgvppasqnlsinpmllltgrtwkgavyggfkskegipklvadfmak
Timeline for d1u3vb2: