Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (2 families) |
Family c.95.1.2: Chalcone synthase-like [53914] (8 proteins) |
Protein Dihydropinosylvin synthase [117752] (1 species) |
Species Scots pine (Pinus sylvestris) [TaxId:3349] [117753] (1 PDB entry) |
Domain d1u0ud2: 1u0u D:238-393 [112929] |
PDB Entry: 1u0u (more details), 2.11 Å
SCOP Domain Sequences for d1u0ud2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u0ud2 c.95.1.2 (D:238-393) Dihydropinosylvin synthase {Scots pine (Pinus sylvestris) [TaxId: 3349]} acfeivwtaqtvvpnsegaiggkvrevgltfqlkgavpdlisaniencmveafsqfkisd wnklfwvvhpggraildrveaklnldptkliptrhvmseygnmssacvhfildqtrkasl qngcsttgeglemgvlfgfgpgltietvvlksvpiq
Timeline for d1u0ud2: