Lineage for d1u0bb2 (1u0b B:1-315)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2468308Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2468309Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2468310Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 2468322Protein Cysteinyl-tRNA synthetase (CysRS) [75161] (1 species)
  7. 2468323Species Escherichia coli [TaxId:562] [75162] (3 PDB entries)
    Uniprot P21888
  8. 2468324Domain d1u0bb2: 1u0b B:1-315 [112905]
    Other proteins in same PDB: d1u0bb1
    protein/RNA complex; complexed with zn

Details for d1u0bb2

PDB Entry: 1u0b (more details), 2.3 Å

PDB Description: Crystal structure of cysteinyl-tRNA synthetase binary complex with tRNACys
PDB Compounds: (B:) cysteinyl tRNA

SCOPe Domain Sequences for d1u0bb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u0bb2 c.26.1.1 (B:1-315) Cysteinyl-tRNA synthetase (CysRS) {Escherichia coli [TaxId: 562]}
mlkifntltrqkeefkpihagevgmyvcgitvydlchighgrtfvafdvvarylrflgyk
lkyvrnitdiddkiikranengesfvamvdrmiaemhkdfdalnilrpdmeprathhiae
iielteqliakghayvadngdvmfdvptdptygvlsrqdldqlqagarvdvvddkrnpmd
fvlwkmskegepswpspwgagrpgwhiecsamnckqlgnhfdihgggsdlmfphheneia
qstcahdgqyvnywmhsgmvmvdrekmskslgnfftvrdvlkyydaetvryflmsghyrs
qlnyseenlkqaraa

SCOPe Domain Coordinates for d1u0bb2:

Click to download the PDB-style file with coordinates for d1u0bb2.
(The format of our PDB-style files is described here.)

Timeline for d1u0bb2: