SCOP 1.73: Domain d1tzlb1: 1tzl B:43-354,B:553-619

Lineage for d1tzlb1 (1tzl B:43-354,B:553-619)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
   core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (7 families)

5. Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (15 proteins)
   C-terminal domain is alpha+beta is common for the family

6. Protein Pyranose 2-oxidase [117439] (1 species)

7. Species White-rot fungus (Peniophora sp. SG) [TaxId:204723] [117440] (5 PDB entries)

8. Domain d1tzlb1: 1tzl B:43-354,B:553-619 [112878]
   Other proteins in same PDB: d1tzla2, d1tzlb2, d1tzlc2, d1tzld2, d1tzle2, d1tzlf2, d1tzlg2, d1tzlh2

Details for d1tzlb1

PDB Entry: 1tzl, 2.35 Å

PDB Description: crystal structure of pyranose 2-oxidase from the white-rot fungus peniophora sp.

PDB Compounds: (B:) Pyranose oxidase

SCOP Domain Sequences for d1tzlb1:

Sequence; same for both SEQRES and ATOM records:

>d1tzlb1 c.3.1.2 (B:43-354,B:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]}
mdikydvvivgsgpigctyarelvgagykvamfdigeidsglkigahkkntveyqknidk
fvnviqgqlmsvsvpvntlvvdtlsptswqastffvrngsnpeqdplrnlsgqavtrvvg
gmsthwtcatprfdreqrpllvkddadaddaewdrlytkaesyfqtgtdqfkesirhnlv
lnklaeeykgqrdfqqiplaatrrsptfvewssantvfdlqnrpntdapeerfnlfpava
cervvrnalnseieslhihdlisgdrfeikadvyvltagavhntqllvnsgfgqlgrpnp
tnppellpslgsXhrmgfdekednccvntdsrvfgfknlflggcgniptayganptltam
slaiksceyikqnftpspft

Timeline for d1tzlb1:

• d1tzlb1 first appeared in SCOP 1.71
  
• d1tzlb1 appears in SCOP 1.75
  
• d1tzlb1 appears in the current release, SCOPe 2.08