Lineage for d1tzlg2 (1tzl G:355-552)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 718307Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 718308Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (7 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 718309Family d.16.1.1: GMC oxidoreductases [54374] (5 proteins)
  6. 718343Protein Pyranose 2-oxidase [117843] (1 species)
  7. 718344Species White-rot fungus (Peniophora sp. SG) [TaxId:204723] [117844] (5 PDB entries)
  8. 718369Domain d1tzlg2: 1tzl G:355-552 [112889]
    Other proteins in same PDB: d1tzla1, d1tzlb1, d1tzlc1, d1tzld1, d1tzle1, d1tzlf1, d1tzlg1, d1tzlh1

Details for d1tzlg2

PDB Entry: 1tzl (more details), 2.35 Å

PDB Description: crystal structure of pyranose 2-oxidase from the white-rot fungus peniophora sp.
PDB Compounds: (G:) Pyranose oxidase

SCOP Domain Sequences for d1tzlg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tzlg2 d.16.1.1 (G:355-552) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]}
yiteqslvfcqtvmstelidsvksdmtirgtpgeltysvtytpgastnkhpdwwnekvkn
hmmqhqedplpipfedpepqvttlfqpshpwhtqihrdafsygavqqsidsrlivdwrff
grtepkeenklwfsdkitdaynmpqptfdfrfpagrtskeaedmmtdmcvmsakiggflp
gslpqfmepglvlhlggt

SCOP Domain Coordinates for d1tzlg2:

Click to download the PDB-style file with coordinates for d1tzlg2.
(The format of our PDB-style files is described here.)

Timeline for d1tzlg2: