Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.198: Secretion chaperone-like [69634] (5 superfamilies) alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta |
Superfamily d.198.2: Arp2/3 complex subunits [69645] (1 family) |
Family d.198.2.1: Arp2/3 complex subunits [69646] (3 proteins) |
Protein ARPC4 (20 kDa subunit) [69647] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [69648] (17 PDB entries) Uniprot P59998 # 100% sequence identity |
Domain d1tyqf_: 1tyq F: [112848] Other proteins in same PDB: d1tyqa1, d1tyqa2, d1tyqb1, d1tyqc_, d1tyqd1, d1tyqd2, d1tyqe_, d1tyqg_ complexed with atp, ca |
PDB Entry: 1tyq (more details), 2.55 Å
SCOPe Domain Sequences for d1tyqf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tyqf_ d.198.2.1 (F:) ARPC4 (20 kDa subunit) {Cow (Bos taurus) [TaxId: 9913]} atlrpylsavratlqaalclenfssqvverhnkpevevrsskelllqpvtisrnekekvl iegsinsvrvsiavkqadeiekilchkfmrfmmmraenffilrrkpvegydisflitnfh teqmykhklvdfvihfmeeidkeisemklsvnararivaeeflknf
Timeline for d1tyqf_: