![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
![]() | Superfamily c.52.3: Eukaryotic RPB5 N-terminal domain [53036] (1 family) ![]() |
![]() | Family c.52.3.1: Eukaryotic RPB5 N-terminal domain [53037] (1 protein) |
![]() | Protein Eukaryotic RPB5 N-terminal domain [53038] (2 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53039] (26 PDB entries) Uniprot P20434; part of multichain biological unit |
![]() | Domain d1twge1: 1twg E:1-143 [112742] Other proteins in same PDB: d1twga_, d1twgb_, d1twgc1, d1twgc2, d1twge2, d1twgf_, d1twgh_, d1twgi1, d1twgi2, d1twgj_, d1twgk_, d1twgl_ protein/RNA complex; complexed with ctp, mn, zn |
PDB Entry: 1twg (more details), 3.3 Å
SCOPe Domain Sequences for d1twge1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1twge1 c.52.3.1 (E:1-143) Eukaryotic RPB5 N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mdqenernisrlwrafrtvkemvkdrgyfitqeevelpledfkakycdsmgrpqrkmmsf qanpteesiskfpdmgslwvefcdepsvgvktmktfvihiqeknfqtgifvyqnnitpsa mklvpsippatietfneaalvvn
Timeline for d1twge1: