Lineage for d1tt7d1 (1tt7 D:2-127,D:295-330)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 666133Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 666134Superfamily b.35.1: GroES-like [50129] (2 families) (S)
  5. 666255Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 666510Protein Hypothetical protein YhfP [117171] (1 species)
  7. 666511Species Bacillus subtilis [TaxId:1423] [117172] (2 PDB entries)
  8. 666515Domain d1tt7d1: 1tt7 D:2-127,D:295-330 [112629]
    Other proteins in same PDB: d1tt7a2, d1tt7b2, d1tt7c2, d1tt7d2, d1tt7e2, d1tt7f2

Details for d1tt7d1

PDB Entry: 1tt7 (more details), 2.7 Å

PDB Description: crystal structure of bacillus subtilis protein yhfp
PDB Compounds: (D:) yhfp

SCOP Domain Sequences for d1tt7d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tt7d1 b.35.1.2 (D:2-127,D:295-330) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]}
stlfqalqaeknaddvsvhvktistedlpkdgvlikvaysginykdglagkaggnivrey
plilgidaagtvvssndprfaegdeviatsyelgvsrdgglseyasvpgdwlvplpqnls
lkeamvXdqlltivdrevsleetpgalkdilqnriqgrvivkl

SCOP Domain Coordinates for d1tt7d1:

Click to download the PDB-style file with coordinates for d1tt7d1.
(The format of our PDB-style files is described here.)

Timeline for d1tt7d1: