Lineage for d1tnyd_ (1tny D:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 541757Fold a.102: alpha/alpha toroid [48207] (5 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 541951Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (4 families) (S)
  5. 542076Family a.102.4.3: Protein prenyltransferases [48246] (2 proteins)
  6. 542077Protein Protein farnesyltransferase, beta-subunit [48247] (2 species)
  7. 542078Species Human (Homo sapiens) [TaxId:9606] [69090] (14 PDB entries)
  8. 542101Domain d1tnyd_: 1tny D: [112572]
    Other proteins in same PDB: d1tnya_, d1tnyc_, d1tnye_, d1tnyg_, d1tnyi_, d1tnyk_

Details for d1tnyd_

PDB Entry: 1tny (more details), 2.7 Å

PDB Description: rat protein geranylgeranyltransferase type-i complexed with a ggpp analog and a frekkffcail peptide derived from the heterotrimeric g protein gamma-2 subunit

SCOP Domain Sequences for d1tnyd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tnyd_ a.102.4.3 (D:) Protein farnesyltransferase, beta-subunit {Human (Homo sapiens)}
ldflrdrhvrffqrclqvlperyssletsrltiaffalsgldmldsldvvnkddiiewiy
slqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsghiamtytglscliilgd
dlsrvdkeaclaglralqledgsfcavpegsendmrfvycascicymlnnwsgmdmkkai
syirrsmsydnglaqgagleshggstfcgiaslclmgkleevfsekelnrikrwcimrqq
ngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyilstqdrlvggfakwpdshp
dalhayfgicglslmeesgickvhpalnvstrtserlrdlhqswkt

SCOP Domain Coordinates for d1tnyd_:

Click to download the PDB-style file with coordinates for d1tnyd_.
(The format of our PDB-style files is described here.)

Timeline for d1tnyd_: