Class a: All alpha proteins [46456] (284 folds) |
Fold a.102: alpha/alpha toroid [48207] (6 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies |
Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (4 families) |
Family a.102.4.3: Protein prenyltransferases [48246] (2 proteins) |
Protein Protein farnesyltransferase, beta-subunit [48247] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [69090] (19 PDB entries) Uniprot P49356 |
Domain d1tn6b_: 1tn6 B: [112528] Other proteins in same PDB: d1tn6a_ complexed with acy, fii, suc, zn; mutant |
PDB Entry: 1tn6 (more details), 1.8 Å
SCOP Domain Sequences for d1tn6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tn6b_ a.102.4.3 (B:) Protein farnesyltransferase, beta-subunit {Human (Homo sapiens) [TaxId: 9606]} sspvwseplyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlq rekhfhylkrglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcq speggfgggpgqyphlaptyaavnalciigteeaydiinrekllqylyslkqpdgsflmh vggevdvrsaycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfc glaalvilkrerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhra lhaqgdpalsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaq hfgsgamlhdvvlgvpenalqpthpvynigpdkviqattyflqkpvpgfe
Timeline for d1tn6b_: