Class a: All alpha proteins [46456] (289 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (10 proteins) |
Protein Dodecameric ferritin homolog [47250] (16 species) |
Species Halobacterium salinarum [TaxId:2242] [101135] (5 PDB entries) Uniprot Q9HMP7 |
Domain d1tkpa_: 1tkp A: [112478] complexed with fe, na, so4 |
PDB Entry: 1tkp (more details), 2.2 Å
SCOPe Domain Sequences for d1tkpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tkpa_ a.25.1.1 (A:) Dodecameric ferritin homolog {Halobacterium salinarum [TaxId: 2242]} stqknaratagevegsdalrmdadraeqcvdalnadlanvyvlyhqlkkhhwnvegaefr dlhlflgeaaetaeevadelaervqalggvphaspetlqaeasvdvededvydirtslan dmaiygdiieatrehtelaenlgdhatahmlreglieleddahhiehyleddtlvtqgal
Timeline for d1tkpa_: