Lineage for d1tjca_ (1tjc A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338494Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2339718Superfamily a.118.8: TPR-like [48452] (10 families) (S)
  5. 2339719Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (21 proteins)
    this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain
  6. 2339835Protein Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 [117007] (1 species)
  7. 2339836Species Human (Homo sapiens) [TaxId:9606] [117008] (1 PDB entry)
    Uniprot P13674 161-254
  8. 2339837Domain d1tjca_: 1tjc A: [112440]

Details for d1tjca_

PDB Entry: 1tjc (more details), 2.3 Å

PDB Description: crystal structure of peptide-substrate-binding domain of human type i collagen prolyl 4-hydroxylase
PDB Compounds: (A:) Prolyl 4-hydroxylase alpha-1 subunit

SCOPe Domain Sequences for d1tjca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]}
mfltaedsfelgkvayteadyyhtelwmeqalrqldegeistidkvsvldylsyavyqqg
dldkallltkklleldpehqrangnlkyfeyimak

SCOPe Domain Coordinates for d1tjca_:

Click to download the PDB-style file with coordinates for d1tjca_.
(The format of our PDB-style files is described here.)

Timeline for d1tjca_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1tjcb_