SCOP 1.71: Domain d1szrd1: 1szr D:37-43,D:284-408

Lineage for d1szrd1 (1szr D:37-43,D:284-408)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
   barrel, closed; n=6, S=8; greek-key

4. Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families)
   the barrel is decorated with additional structures

5. Family b.49.2.3: Eukaryotic ODC-like [88683] (2 proteins)
   barrel is open with strands 4 and 5 having swapped their positions, compared to the alanine racemase barrel

6. Protein Eukaryotic ornithine decarboxylase (ODC) [50625] (3 species)

7. Species Trypanosoma brucei [TaxId:5691] [50628] (5 PDB entries)

8. Domain d1szrd1: 1szr D:37-43,D:284-408 [112180]
   Other proteins in same PDB: d1szra2, d1szrb2, d1szrc2, d1szrd2
   complexed with orx, plg, pxp; mutant

Details for d1szrd1

PDB Entry: 1szr, 2.15 Å

PDB Description: a dimer interface mutant of ornithine decarboxylase reveals structure of gem diamine intermediate

SCOP Domain Sequences for d1szrd1:

Sequence, based on SEQRES records:

>d1szrd1 b.49.2.3 (D:37-43,D:284-408) Eukaryotic ornithine decarboxylase (ODC) {Trypanosoma brucei}
gdpffvaXftlavnviakavtpgvqtdvgahaesnaqsfmyyvndgvygsfncilydhav
vrplpqrepipneklypssvwgptcdgldqiveryylpemqvgewllfedmgaytvvgts
sfngfqsptiyyv

Sequence, based on observed residues (ATOM records):

>d1szrd1 b.49.2.3 (D:37-43,D:284-408) Eukaryotic ornithine decarboxylase (ODC) {Trypanosoma brucei}
gdpffvaXftlavnviakavtpaqsfmyyvndgvygsfncilydhavvrplpqrepipne
klypssvwgptcdgldqiveryylpemqvgewllfedmgaytvvgtssfngfqsptiyyv

Timeline for d1szrd1:

• d1szrd1 is new in SCOP 1.71
  
• d1szrd1 appears in SCOP 1.73
  
• d1szrd1 appears in the current release, SCOPe 2.08