SCOPe 2.04: Domain d1rmza_: 1rmz A:

Lineage for d1rmza_ (1rmz A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)

6. Protein Macrophage elastase (MMP-12) [69780] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69781] (36 PDB entries)
   Uniprot P39900 106-263 ! Uniprot P39900 106-264

8. Domain d1rmza_: 1rmz A: [111896]
   complexed with ca, ngh, zn

Details for d1rmza_

PDB Entry: 1rmz, 1.34 Å

PDB Description: crystal structure of the catalytic domain of human mmp12 complexed with the inhibitor nngh at 1.3 a resolution

PDB Compounds: (A:) Macrophage metalloelastase

SCOPe Domain Sequences for d1rmza_:

Sequence; same for both SEQRES and ATOM records:

>d1rmza_ d.92.1.11 (A:) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]}
mgpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfa
rgahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighsl
glghssdpkavmfptykyvdintfrlsaddirgiqslyg

Timeline for d1rmza_:

• d1rmza_ first appeared in SCOP 1.71
  
• d1rmza_ appears in SCOPe 2.03
  
• d1rmza_ appears in SCOPe 2.05
  
• d1rmza_ appears in the current release, SCOPe 2.08, called d1rmza1