Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) |
Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (13 proteins) |
Protein 4-hydroxybenzoyl-CoA reductase gamma subunit HrcC, N-terminal domain [117836] (1 species) |
Species Thauera aromatica [TaxId:59405] [117837] (2 PDB entries) |
Domain d1rm6f2: 1rm6 F:1-81 [111883] Other proteins in same PDB: d1rm6a1, d1rm6a2, d1rm6b1, d1rm6b2, d1rm6c1, d1rm6d1, d1rm6d2, d1rm6e1, d1rm6e2, d1rm6f1 complexed with cl, epe, fad, fes, fs4, k, na, pcd, so4 |
PDB Entry: 1rm6 (more details), 1.6 Å
SCOP Domain Sequences for d1rm6f2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rm6f2 d.15.4.2 (F:1-81) 4-hydroxybenzoyl-CoA reductase gamma subunit HrcC, N-terminal domain {Thauera aromatica [TaxId: 59405]} mknilrltlngraredlvpdnmllldylretvgltgtkqgcdggecgactvlvddrprla cstlahqvagkkvetveslat
Timeline for d1rm6f2: