SCOPe 2.08: Domain d1r9jb2: 1r9j B:1-336

Lineage for d1r9jb2 (1r9j B:1-336)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.10: TK-like PP module [88760] (3 proteins)
   different order of the modules, PP module is N-terminal, Pyr module is next to it followed by a Rossmann-like domain

6. Protein Transketolase (TK), PP module [88761] (4 species)

7. Species Leishmania mexicana mexicana [TaxId:44270] [117524] (1 PDB entry)
   Uniprot Q8MPM3

8. Domain d1r9jb2: 1r9j B:1-336 [111726]
   Other proteins in same PDB: d1r9ja1, d1r9ja3, d1r9ja4, d1r9jb1, d1r9jb3, d1r9jb4
   complexed with ca, tpp

Details for d1r9jb2

PDB Entry: 1r9j, 2.22 Å

PDB Description: Transketolase from Leishmania mexicana

PDB Compounds: (B:) transketolase

SCOPe Domain Sequences for d1r9jb2:

Sequence; same for both SEQRES and ATOM records:

>d1r9jb2 c.36.1.10 (B:1-336) Transketolase (TK), PP module {Leishmania mexicana mexicana [TaxId: 44270]}
masiekvancirclaadivqggksghpgtpmgmapmsavlwtevmkynsqdpdwvdrdrf
vmsnghgcalqyallhmagynltmddlkgfrqdgsrtpghperfvtpgvevttgplgqgi
anavglaiaeahlaatfnrpgynivdhytyvycgdgclmegvcqealslaghlalekliv
iydsnyisidgstslsfteqchqkyvamgfhvievkngdtdyeglrkalaeakatkgkpk
mivqtttigfgsskqgtekvhgaplgeedianikakfgrdpqkkydvdddvravfrmhid
kcsaeqkaweellakytaafpaegaafvaqmrgelp

Timeline for d1r9jb2:

• d1r9jb2 first appeared in SCOP 1.71
  
• d1r9jb2 appears in SCOPe 2.07