Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
Family c.36.1.6: TK-like Pyr module [88735] (2 proteins) different order of the modules, PP module is N-terminal, Pyr module is next to it followed by a Rossmann-like domain |
Protein Transketolase (TK), Pyr module [88736] (4 species) |
Species Leishmania mexicana mexicana [TaxId:44270] [117521] (1 PDB entry) Uniprot Q8MPM3 |
Domain d1r9jb1: 1r9j B:337-526 [111725] Other proteins in same PDB: d1r9ja2, d1r9ja3, d1r9ja4, d1r9jb2, d1r9jb3, d1r9jb4 complexed with ca, tpp |
PDB Entry: 1r9j (more details), 2.22 Å
SCOPe Domain Sequences for d1r9jb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r9jb1 c.36.1.6 (B:337-526) Transketolase (TK), Pyr module {Leishmania mexicana mexicana [TaxId: 44270]} sgweaklptnssaiatrkasenclavlfpaipalmggsadltpsnltrpasanlvdfsss skegryirfgvrehamcailngldahdgiipfggtflnfigyalgavrlaaishhrviyv athdsigvgedgpthqpvelvaalrampnlqvirpsdqtetsgawavalssihtptvlcl srqntepqsg
Timeline for d1r9jb1:
View in 3D Domains from other chains: (mouse over for more information) d1r9ja1, d1r9ja2, d1r9ja3, d1r9ja4 |