SCOP 1.73: Domain d1tu0c3: 1tu0 C:151-310

Lineage for d1tu0c3 (1tu0 C:151-310)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (1 family)

5. Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (3 proteins)

6. Protein Aspartate carbamoyltransferase catalytic subunit [53673] (4 species)

7. Species Escherichia coli [TaxId:562] [53674] (45 PDB entries)

8. Domain d1tu0c3: 1tu0 C:151-310 [111608]
   Other proteins in same PDB: d1tu0b1, d1tu0b2, d1tu0d1, d1tu0d2
   complexed with pct, zn; mutant

Details for d1tu0c3

PDB Entry: 1tu0, 2.55 Å

PDB Description: aspartate transcarbamoylase catalytic chain mutant e50a complex with phosphonoacetamide

PDB Compounds: (C:) Aspartate carbamoyltransferase catalytic chain

SCOP Domain Sequences for d1tu0c3:

Sequence; same for both SEQRES and ATOM records:

>d1tu0c3 c.78.1.1 (C:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]}
rldnlhvamvgdlkygrtvhsltqalakfdgnrfyfiapdalampqyildmldekgiaws
lhssieevmaevdilymtrvqkerldpseyanvkaqfvlrasdlhnakanmkvlhplprv
deiatdvdktphawyfqqagngifarqallalvlnrdlvl

Timeline for d1tu0c3:

• d1tu0c3 first appeared in SCOP 1.71
  
• d1tu0c3 appears in SCOP 1.75
  
• d1tu0c3 appears in the current release, SCOPe 2.08