Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.286: TrkA C-terminal domain-like [116725] (1 superfamily) beta-X-beta(2)-X-beta-alpha; pseudo barrel capped by helix at one end; topological similarity to the HPr-like fold |
Superfamily d.286.1: TrkA C-terminal domain-like [116726] (2 families) |
Family d.286.1.1: TrkA C-terminal domain-like [116727] (2 proteins) Pfam PF02080 |
Protein Potassium channel-related protein MthK, C-terminal domain [116728] (1 species) |
Species Methanothermobacter thermautotrophicus [TaxId:145262] [116729] (5 PDB entries) |
Domain d1lnqb4: 1lnq B:245-336 [111579] Other proteins in same PDB: d1lnqa2, d1lnqa3, d1lnqb2, d1lnqb3, d1lnqc2, d1lnqc3, d1lnqd2, d1lnqd3, d1lnqe2, d1lnqe3, d1lnqf2, d1lnqf3, d1lnqg2, d1lnqg3, d1lnqh2, d1lnqh3 complexed with ca |
PDB Entry: 1lnq (more details), 3.3 Å
SCOPe Domain Sequences for d1lnqb4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lnqb4 d.286.1.1 (B:245-336) Potassium channel-related protein MthK, C-terminal domain {Methanothermobacter thermautotrophicus [TaxId: 145262]} dgyeamfvqdvlaeestrrmvevpipegsklegvsvldadihdvtgviiigvgrgdelii dpprdysfragdiilgigkpeeierlknyisa
Timeline for d1lnqb4: